PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P03120_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 290aa    MW: 32763.2 Da    PI: 5.2619
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P03120_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.8e-092132511755
                            HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            el +k +yps++++  LA+ +gL+ +q+ +WF N+R ++
  GSMUA_Achr4P03120_001 213 ELHYKWPYPSETQKVALAEATGLDLKQINNWFINQRKRH 251
                            5556789*****************************885 PP

2ELK38.13.2e-13171192122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+Ll+KYsgyL+sL+qE+s
  GSMUA_Achr4P03120_001 171 ELKHHLLKKYSGYLSSLRQELS 192
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037901.3E-45169IPR005540KNOX1
SMARTSM012562.1E-2477128IPR005541KNOX2
PfamPF037913.4E-2283126IPR005541KNOX2
PROSITE profilePS5121311.523171191IPR005539ELK domain
SMARTSM011882.8E-7171192IPR005539ELK domain
PfamPF037892.8E-10171192IPR005539ELK domain
PROSITE profilePS5007112.471191254IPR001356Homeobox domain
SuperFamilySSF466898.98E-20192267IPR009057Homeodomain-like
SMARTSM003892.9E-12193258IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-27196256IPR009057Homeodomain-like
CDDcd000865.52E-12203255No hitNo description
PfamPF059203.2E-16211250IPR008422Homeobox KN domain
PROSITE patternPS000270229252IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEEFSQLGAN LWGGLMCTTS PAEKTAVDAA TVAMFGLPSG DAKGRCIPSP VGAPPEVVAR  60
LSAVAQELEM RQRANFICRD SPTDPELDQF MEAYNEMLIK YREELTRPLQ EAMEFLRMME  120
SQLNSLALTT GSVRISSAAE KFGVCSSGDD QDGNTDNAEP PELVASAEDR ELKHHLLKKY  180
SGYLSSLRQE LSKKKKKGKL PKDARQQLLN WWELHYKWPY PSETQKVALA EATGLDLKQI  240
NNWFINQRKR HWKPSEDMQF VVMDGYHAPN TALYMDGQYF MGDDLYRLGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395206.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotP466091e-112KNOS6_ORYSJ; Homeobox protein knotted-1-like 6
TrEMBLM0SKM90.0M0SKM9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P03120_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-84KNOTTED-like from Arabidopsis thaliana